Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os04g48070.1
Common NameGL2-4, LOC4336705, Os04g0569100, OSJNBb0032E06.7, ROC4
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HD-ZIP
Protein Properties Length: 814aa    MW: 86758 Da    PI: 5.7216
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os04g48070.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++eLe++F+++++p++++r+eL+k+lgL+ rqVk+WFqNrR+++k
                       688999***********************************************998 PP

             START   2 laeeaaqelvkkalaeepgWvkss........esengdevlqkfeeskv.....dsgealrasgvvdmv.lallveellddkeqWdetla... 77 
                       la +a++elvk+a+ ++p+W   +        es+n +e+l +f++  +     + +ea+r+sg+v+ +  a lve+l+d + +W+ ++    
                       67899***************9766667999****************9999**************998651558*********.********** PP

             START  78 .kaetlevissg.............galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.....sssvvRaellpS 150
                        ka+t+e is+g              +  +m+aelq+lsplvp R++ f+R+++ql +g+w++vdvS d+    +      s   + +++lpS
                       ******************99999999999***************************************9987666666454555689****** PP

             START 151 giliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                       g+++++++ng  kvtwveh++++++++h l+r+l++sgla ga +w atlqrqce+
                       ******************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007118.366102162IPR001356Homeobox domain
SMARTSM003893.2E-20103166IPR001356Homeobox domain
CDDcd000861.13E-20104160No hitNo description
PfamPF000467.5E-20105160IPR001356Homeobox domain
PRINTSPR000318.7E-5133142IPR000047Helix-turn-helix motif
PROSITE patternPS000270137160IPR017970Homeobox, conserved site
PRINTSPR000318.7E-5142158IPR000047Helix-turn-helix motif
PROSITE profilePS5084841.854306559IPR002913START domain
SuperFamilySSF559612.2E-23309556No hitNo description
CDDcd088756.19E-103310555No hitNo description
SMARTSM002344.2E-35315556IPR002913START domain
PfamPF018529.1E-40316556IPR002913START domain
SuperFamilySSF559613.85E-17576778No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 814 aa     Download sequence    Send to blast
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.88330.0callus| flower| leaf| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
Expression AtlasQ7Y0V9-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Phenotype -- Mutation ? help Back to Top
Source ID
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1016470.0AB101647.1 Oryza sativa Japonica Group Roc4 mRNA for GL2-type homeodomain protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637147.10.0PREDICTED: homeobox-leucine zipper protein ROC4
SwissprotQ7Y0V90.0ROC4_ORYSJ; Homeobox-leucine zipper protein ROC4
TrEMBLI1PNZ40.0I1PNZ4_ORYGL; Uncharacterized protein
STRINGLOC_Os04g48070.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein